| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Thielavia arenaria [TaxId:113610] [256023] (1 PDB entry) |
| Domain d3ppsb1: 3pps B:1-163 [248558] automated match to d2q9oa1 complexed with cu, nag, oxy |
PDB Entry: 3pps (more details), 2.5 Å
SCOPe Domain Sequences for d3ppsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ppsb1 b.6.1.0 (B:1-163) automated matches {Thielavia arenaria [TaxId: 113610]}
sgptcntpsnracwtngfdintdyevstpntgrtvayqltltekenwigpdgvlknvvml
vndkiigptiranwgdnievtvinnlktngtsmhwhglrqlgnvfndgangvtecpippk
ggrktykfratqygtswyhshfsaqygngvvgtiqidgpaslp
Timeline for d3ppsb1: