SCOPe 2.06: Domain d3ppqb_: 3ppq B:

Lineage for d3ppqb_ (3ppq B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:535025] [189693] (4 PDB entries)

8. Domain d3ppqb_: 3ppq B: [248552]
   automated match to d3r6ua_
   complexed with cht

Details for d3ppqb_

PDB Entry: 3ppq, 1.91 Å

PDB Description: Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of Bacillus subtilis ABC transporter OpuC

PDB Compounds: (B:) Glycine betaine/carnitine/choline-binding protein

SCOPe Domain Sequences for d3ppqb_:

Sequence; same for both SEQRES and ATOM records:

>d3ppqb_ c.94.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 535025]}
tikigaqsmteseivanmiaqliehdtdlntalvknlgsnyvqhqamlggdidisatrys
gtdltstlgkeaekdpkkalnivqnefqkrfsykwfdsygfdntyaftvtkkfaekehin
tvsdlkknasqyklgvdnawlkrkgdgykgfvstygfefgttypmqiglvydavkngkmd
avlaystdgrikaydlkilkddkrffppydcspvipekvlkehpelegvinkligqidte
tmqelnyevdgklkepsvvakeflekhhyfd

Timeline for d3ppqb_:

• d3ppqb_ first appeared in SCOPe 2.04
  
• d3ppqb_ appears in SCOPe 2.05
  
• d3ppqb_ appears in SCOPe 2.07
  
• d3ppqb_ appears in the current release, SCOPe 2.08