Lineage for d2snma_ (2snm A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540030Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1540031Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1540032Protein Staphylococcal nuclease [50201] (1 species)
  7. 1540033Species Staphylococcus aureus [TaxId:1280] [50202] (197 PDB entries)
    Uniprot P00644 89-223
  8. 1540190Domain d2snma_: 2snm A: [24855]
    complexed with ca, thp; mutant

Details for d2snma_

PDB Entry: 2snm (more details), 1.97 Å

PDB Description: in a staphylococcal nuclease mutant the side-chain of a lysine replacing valine 66 is fully buried in the hydrophobic core
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d2snma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2snma_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmk
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws

SCOPe Domain Coordinates for d2snma_:

Click to download the PDB-style file with coordinates for d2snma_.
(The format of our PDB-style files is described here.)

Timeline for d2snma_: