SCOPe 2.08: Domain d3ppnb_: 3ppn B:

Lineage for d3ppnb_ (3ppn B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187940] (8 PDB entries)

8. Domain d3ppnb_: 3ppn B: [248546]
   automated match to d3r6ua_

Details for d3ppnb_

PDB Entry: 3ppn, 2.3 Å

PDB Description: Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of Bacillus subtilis ABC transporter OpuC

PDB Compounds: (B:) Glycine betaine/carnitine/choline-binding protein

SCOPe Domain Sequences for d3ppnb_:

Sequence; same for both SEQRES and ATOM records:

>d3ppnb_ c.94.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
dtikigaqsmteseivanmiaqliehdtdlntalvknlgsnyvqhqamlggdidisatry
sgtdltstlgkeaekdpkkalnivqnefqkrfsykwfdsygfdntyaftvtkkfaekehi
ntvsdlkknasqyklgvdnawlkrkgdgykgfvstygfefgttypmqiglvydavkngkm
davlaystdgrikaydlkilkddkrffppydcspvipekvlkehpelegvinkligqidt
etmqelnyevdgklkepsvvakeflekhhy

Timeline for d3ppnb_:

• d3ppnb_ first appeared in SCOPe 2.04
  
• d3ppnb_ appears in SCOPe 2.07