Lineage for d3pnca2 (3pnc A:329-385)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716399Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2716577Protein DNA polymerase lambda [101253] (1 species)
  7. 2716578Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)
  8. 2716584Domain d3pnca2: 3pnc A:329-385 [248541]
    Other proteins in same PDB: d3pnca1, d3pnca3
    automated match to d1xsna2
    protein/DNA complex; complexed with 1gc, mg, na, trs

Details for d3pnca2

PDB Entry: 3pnc (more details), 2 Å

PDB Description: Ternary crystal structure of a polymerase lambda variant with a GT mispair at the primer terminus and sodium at catalytic metal site
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3pnca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pnca2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d3pnca2:

Click to download the PDB-style file with coordinates for d3pnca2.
(The format of our PDB-style files is described here.)

Timeline for d3pnca2: