SCOPe 2.05: Domain d3pmzh_: 3pmz H:

Lineage for d3pmzh_ (3pmz H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)

8. Domain d3pmzh_: 3pmz H: [248537]
   automated match to d2c9ta_
   complexed with mg, tub

Details for d3pmzh_

PDB Entry: 3pmz, 2.44 Å

PDB Description: crystal structure of the complex of acetylcholine binding protein and d-tubocurarine

PDB Compounds: (H:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3pmzh_:

Sequence, based on SEQRES records:

>d3pmzh_ b.96.1.0 (H:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyy
eqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsv
mfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskye
ilsatqtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records):

>d3pmzh_ b.96.1.0 (H:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dddklhsqanlmrlksdlfnrsmypgptkddpltvtlgftlqdivkadsstnevdlvyye
qqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvm
fipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyei
lsatqtrqvqhysccpepyidvnlvvkfrerr

Timeline for d3pmzh_:

• d3pmzh_ first appeared in SCOPe 2.04
  
• d3pmzh_ is called d3pmzh1 in SCOPe 2.06
  
• d3pmzh_ appears in the current release, SCOPe 2.08, called d3pmzh1