SCOPe 2.06: Domain d3pmzc1: 3pmz C:1-208

Lineage for d3pmzc1 (3pmz C:1-208)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d3pmzc1: 3pmz C:1-208 [248532]
   Other proteins in same PDB: d3pmza2, d3pmzb2, d3pmzc2, d3pmzd2, d3pmze2, d3pmzg2, d3pmzh2, d3pmzi2, d3pmzj2
   automated match to d2c9ta_
   complexed with mg, tub

Details for d3pmzc1

PDB Entry: 3pmz, 2.44 Å

PDB Description: crystal structure of the complex of acetylcholine binding protein and d-tubocurarine

PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3pmzc1:

Sequence, based on SEQRES records:

>d3pmzc1 b.96.1.0 (C:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records):

>d3pmzc1 b.96.1.0 (C:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrsmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerr

Timeline for d3pmzc1:

• d3pmzc1 first appeared in SCOPe 2.04, called d3pmzc_
  
• d3pmzc1 was called d3pmzc_ in SCOPe 2.05
  
• d3pmzc1 appears in SCOPe 2.07
  
• d3pmzc1 appears in the current release, SCOPe 2.08