Lineage for d3pmza_ (3pmz A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561825Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1561826Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1562052Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1562053Protein automated matches [193506] (4 species)
    not a true protein
  7. 1562054Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (36 PDB entries)
  8. 1562235Domain d3pmza_: 3pmz A: [248530]
    automated match to d2c9ta_
    complexed with mg, tub

Details for d3pmza_

PDB Entry: 3pmz (more details), 2.44 Å

PDB Description: crystal structure of the complex of acetylcholine binding protein and d-tubocurarine
PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3pmza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmza_ b.96.1.0 (A:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyy
eqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsv
mfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskye
ilsatqtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d3pmza_:

Click to download the PDB-style file with coordinates for d3pmza_.
(The format of our PDB-style files is described here.)

Timeline for d3pmza_: