Lineage for d1ey7a_ (1ey7 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667293Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 667294Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 667295Protein Staphylococcal nuclease [50201] (1 species)
  7. 667296Species Staphylococcus aureus [TaxId:1280] [50202] (68 PDB entries)
  8. 667340Domain d1ey7a_: 1ey7 A: [24853]
    mutant

Details for d1ey7a_

PDB Entry: 1ey7 (more details), 1.88 Å

PDB Description: structure of s. nuclease stabilizing mutant s128a
PDB Compounds: (A:) staphylococcal nuclease

SCOP Domain Sequences for d1ey7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey7a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kaeaqakkeklniws

SCOP Domain Coordinates for d1ey7a_:

Click to download the PDB-style file with coordinates for d1ey7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ey7a_: