Lineage for d3pmlb1 (3pml B:247-328)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329042Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329043Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2329212Protein DNA polymerase lambda [101251] (1 species)
  7. 2329213Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2329261Domain d3pmlb1: 3pml B:247-328 [248524]
    Other proteins in same PDB: d3pmla2, d3pmla3, d3pmlb2, d3pmlb3
    automated match to d1rzta1
    protein/DNA complex; complexed with 1gc, mg, na

Details for d3pmlb1

PDB Entry: 3pml (more details), 2.6 Å

PDB Description: crystal structure of a polymerase lambda variant with a dgtp analog opposite a templating t
PDB Compounds: (B:) DNA polymerase lambda

SCOPe Domain Sequences for d3pmlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmlb1 a.60.6.1 (B:247-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
qkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgig
krmaekiieilesghlrkldhi

SCOPe Domain Coordinates for d3pmlb1:

Click to download the PDB-style file with coordinates for d3pmlb1.
(The format of our PDB-style files is described here.)

Timeline for d3pmlb1: