![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
![]() | Protein DNA polymerase lambda [101253] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries) |
![]() | Domain d3pmla2: 3pml A:329-385 [248522] Other proteins in same PDB: d3pmla1, d3pmla3, d3pmlb1, d3pmlb3 automated match to d1xsna2 protein/DNA complex; complexed with 1gc, mg, na |
PDB Entry: 3pml (more details), 2.6 Å
SCOPe Domain Sequences for d3pmla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmla2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d3pmla2: