Lineage for d3pm0a_ (3pm0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005669Domain d3pm0a_: 3pm0 A: [248520]
    automated match to d4ejhg_
    complexed with bhf, hem

Details for d3pm0a_

PDB Entry: 3pm0 (more details), 2.7 Å

PDB Description: Structural Characterization of the Complex between Alpha-Naphthoflavone and Human Cytochrome P450 1B1 (CYP1B1)
PDB Compounds: (A:) Cytochrome P450 1B1

SCOPe Domain Sequences for d3pm0a_:

Sequence, based on SEQRES records: (download)

>d3pm0a_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaahlsfarlarrygdvfqirlgscpivvlngeraihqalvqqgsafadrpsfasfrvvs
ggrsmafghysehwkvqrraahsmmrnfftrqprsrqvleghvlsearelvallvrgsad
gafldprpltvvavanvmsavcfgcryshddpefrellshneefgrtvgagslvdvmpwl
qyfpnpvrtvfrefeqlnrnfsnfildkflrhceslrpgaaprdmmdafilsaekkaagd
shgggarldlenvpatitdifgasqdtlstalqwllllftrypdvqtrvqaeldqvvgrd
rlpcmgdqpnlpyvlaflyeamrfssfvpvtiphattantsvlgyhipkdtvvfvnqwsv
nhdplkwpnpenfdparfldkdglinkdltsrvmifsvgkrrcigeelskmqlflfisil
ahqcdfranpnepakmnfsygltikpksfkvnvtlresmelld

Sequence, based on observed residues (ATOM records): (download)

>d3pm0a_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaahlsfarlarrygdvfqirlgscpivvlngeraihqalvqqgsafadrpsfasfrvvs
ggrsmafghysehwkvqrraahsmmrnfftrqprsrqvleghvlsearelvallvrgsad
gafldprpltvvavanvmsavcfgcryshddpefrellshneefgrtvgagslvdvmpwl
qyfpnpvrtvfrefeqlnrnfsnfildkflrhceslrpgaaprdmmdafilsaekkaagd
garldlenvpatitdifgasqdtlstalqwllllftrypdvqtrvqaeldqvvgrdrlpc
mgdqpnlpyvlaflyeamrfssfvpvtiphattantsvlgyhipkdtvvfvnqwsvnhdp
lkwpnpenfdparfldkdglinkdltsrvmifsvgkrrcigeelskmqlflfisilahqc
dfranpnepakmnfsygltikpksfkvnvtlresmelld

SCOPe Domain Coordinates for d3pm0a_:

Click to download the PDB-style file with coordinates for d3pm0a_.
(The format of our PDB-style files is described here.)

Timeline for d3pm0a_: