| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.16: Translin [74784] (2 families) ![]() automatically mapped to Pfam PF01997 |
| Family a.118.16.1: Translin [74785] (2 proteins) |
| Protein automated matches [191293] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189950] (4 PDB entries) |
| Domain d3pjah_: 3pja H: [248517] automated match to d3qb5b_ |
PDB Entry: 3pja (more details), 3 Å
SCOPe Domain Sequences for d3pjah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pjah_ a.118.16.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclka
rehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavte
ilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgf
rllnlkndslrkrydglkydvkkveevvydlsirgf
Timeline for d3pjah_: