Lineage for d3pjac_ (3pja C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007879Superfamily a.118.16: Translin [74784] (2 families) (S)
    automatically mapped to Pfam PF01997
  5. 2007880Family a.118.16.1: Translin [74785] (2 protein domains)
  6. 2007892Protein automated matches [191293] (1 species)
    not a true protein
  7. 2007893Species Human (Homo sapiens) [TaxId:9606] [189950] (4 PDB entries)
  8. 2007896Domain d3pjac_: 3pja C: [248512]
    automated match to d3qb5b_

Details for d3pjac_

PDB Entry: 3pja (more details), 3 Å

PDB Description: Crystal structure of human C3PO complex
PDB Compounds: (C:) Translin

SCOPe Domain Sequences for d3pjac_:

Sequence, based on SEQRES records: (download)

>d3pjac_ a.118.16.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclk
arehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt
eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg
frllnlkndslrkrydglkydvkkveevvydlsirgfnk

Sequence, based on observed residues (ATOM records): (download)

>d3pjac_ a.118.16.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqdipkrclkarehf
gtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgi
epdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrlln
lkndslrkrydglkydvkkveevvydlsirgfnk

SCOPe Domain Coordinates for d3pjac_:

Click to download the PDB-style file with coordinates for d3pjac_.
(The format of our PDB-style files is described here.)

Timeline for d3pjac_: