Lineage for d3pjab_ (3pja B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727384Superfamily a.118.16: Translin [74784] (2 families) (S)
    automatically mapped to Pfam PF01997
  5. 2727385Family a.118.16.1: Translin [74785] (2 proteins)
  6. 2727397Protein automated matches [191293] (1 species)
    not a true protein
  7. 2727398Species Human (Homo sapiens) [TaxId:9606] [189950] (4 PDB entries)
  8. 2727400Domain d3pjab_: 3pja B: [248511]
    automated match to d3qb5b_

Details for d3pjab_

PDB Entry: 3pja (more details), 3 Å

PDB Description: Crystal structure of human C3PO complex
PDB Compounds: (B:) Translin

SCOPe Domain Sequences for d3pjab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pjab_ a.118.16.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclka
rehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavte
ilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgf
rllnlkndslrkrydglkydvkkveevvydlsirgfn

SCOPe Domain Coordinates for d3pjab_:

Click to download the PDB-style file with coordinates for d3pjab_.
(The format of our PDB-style files is described here.)

Timeline for d3pjab_: