Lineage for d3phbs1 (3phb S:1-285)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2140830Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2141593Protein automated matches [190142] (19 species)
    not a true protein
  7. 2141643Species Human (Homo sapiens) [TaxId:9606] [256021] (7 PDB entries)
  8. 2141670Domain d3phbs1: 3phb S:1-285 [248499]
    Other proteins in same PDB: d3phbe2, d3phbq2, d3phbs2, d3phbt2
    automated match to d1ulba_
    complexed with im5, po4

Details for d3phbs1

PDB Entry: 3phb (more details), 2.3 Å

PDB Description: crystal structure of human purine nucleoside phosphorylase in complex with dadme-immg
PDB Compounds: (S:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3phbs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phbs1 c.56.2.1 (S:1-285) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp

SCOPe Domain Coordinates for d3phbs1:

Click to download the PDB-style file with coordinates for d3phbs1.
(The format of our PDB-style files is described here.)

Timeline for d3phbs1: