![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein automated matches [190142] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256021] (7 PDB entries) |
![]() | Domain d3phbq1: 3phb Q:1-285 [248498] Other proteins in same PDB: d3phbe2, d3phbq2, d3phbs2, d3phbt2 automated match to d1ulba_ complexed with im5, po4 |
PDB Entry: 3phb (more details), 2.3 Å
SCOPe Domain Sequences for d3phbq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3phbq1 c.56.2.1 (Q:1-285) automated matches {Human (Homo sapiens) [TaxId: 9606]} mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp
Timeline for d3phbq1: