Lineage for d3phbe_ (3phb E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1608177Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1608178Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 1608825Protein automated matches [190142] (17 species)
    not a true protein
  7. 1608860Species Human (Homo sapiens) [TaxId:9606] [256021] (5 PDB entries)
  8. 1608879Domain d3phbe_: 3phb E: [248497]
    automated match to d1ulba_
    complexed with im5, po4

Details for d3phbe_

PDB Entry: 3phb (more details), 2.3 Å

PDB Description: crystal structure of human purine nucleoside phosphorylase in complex with dadme-immg
PDB Compounds: (E:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3phbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phbe_ c.56.2.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptlmengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfp
rstvpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaa
gglnpkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralst
wkqmgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfg
fslitnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp

SCOPe Domain Coordinates for d3phbe_:

Click to download the PDB-style file with coordinates for d3phbe_.
(The format of our PDB-style files is described here.)

Timeline for d3phbe_: