SCOPe 2.08: Domain d3pfrb1: 3pfr B:7-138

Lineage for d3pfrb1 (3pfr B:7-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries)

8. Domain d3pfrb1: 3pfr B:7-138 [248489]
   Other proteins in same PDB: d3pfra2, d3pfrb2, d3pfrc2, d3pfrd2
   automated match to d3n6ha1
   complexed with gkr, mg

Details for d3pfrb1

PDB Entry: 3pfr, 1.9 Å

PDB Description: Crystal structure of D-Glucarate dehydratase related protein from Actinobacillus Succinogenes complexed with D-Glucarate

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3pfrb1:

Sequence, based on SEQRES records:

>d3pfrb1 d.54.1.0 (B:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
teaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmg
qflgvpvaellg

Sequence, based on observed residues (ATOM records):

>d3pfrb1 d.54.1.0 (B:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellg

Timeline for d3pfrb1:

• d3pfrb1 first appeared in SCOPe 2.04
  
• d3pfrb1 appears in SCOPe 2.07