Lineage for d3peua_ (3peu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2113975Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (12 PDB entries)
  8. 2113982Domain d3peua_: 3peu A: [248485]
    automated match to d1fuka_
    complexed with gol, ihp, so4

Details for d3peua_

PDB Entry: 3peu (more details), 2.6 Å

PDB Description: s. cerevisiae dbp5 l327v c-terminal domain bound to gle1 h337r and ip6
PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d3peua_:

Sequence, based on SEQRES records: (download)

>d3peua_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aikqlymdckneadkfdvltelygvmtigssiifvatkktanvlygklkseghevsilhg
dlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangqadpatyih
rigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevekivkkvlkd

Sequence, based on observed residues (ATOM records): (download)

>d3peua_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aikqlymdckneadkfdvltelygvmtigssiifvatkktanvlygklkseghevsilhg
dlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangqadpatyih
rigrtggrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevekivkkvlkd

SCOPe Domain Coordinates for d3peua_:

Click to download the PDB-style file with coordinates for d3peua_.
(The format of our PDB-style files is described here.)

Timeline for d3peua_: