Lineage for d3peoj_ (3peo J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2819947Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2820062Domain d3peoj_: 3peo J: [248484]
    Other proteins in same PDB: d3peob2, d3peoc2, d3peog2, d3peoh2
    automated match to d2c9ta_
    complexed with cu9

Details for d3peoj_

PDB Entry: 3peo (more details), 2.1 Å

PDB Description: crystal structure of acetylcholine binding protein complexed with metocurine
PDB Compounds: (J:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3peoj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3peoj_ b.96.1.0 (J:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d3peoj_:

Click to download the PDB-style file with coordinates for d3peoj_.
(The format of our PDB-style files is described here.)

Timeline for d3peoj_: