Lineage for d3peod_ (3peo D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561825Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1561826Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1562052Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1562053Protein automated matches [193506] (4 species)
    not a true protein
  7. 1562054Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (36 PDB entries)
  8. 1562118Domain d3peod_: 3peo D: [248478]
    automated match to d2c9ta_
    complexed with cu9

Details for d3peod_

PDB Entry: 3peo (more details), 2.1 Å

PDB Description: crystal structure of acetylcholine binding protein complexed with metocurine
PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3peod_:

Sequence, based on SEQRES records: (download)

>d3peod_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d3peod_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfnrsypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwkln
slmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrl
sfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtr
qvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d3peod_:

Click to download the PDB-style file with coordinates for d3peod_.
(The format of our PDB-style files is described here.)

Timeline for d3peod_: