Lineage for d3pdig_ (3pdi G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912735Species Azotobacter vinelandii [TaxId:322710] [256020] (1 PDB entry)
  8. 2912739Domain d3pdig_: 3pdi G: [248468]
    automated match to d1l5ha_
    complexed with czl, sf4

Details for d3pdig_

PDB Entry: 3pdi (more details), 2.4 Å

PDB Description: Precursor bound NifEN
PDB Compounds: (G:) Nitrogenase MoFe cofactor biosynthesis protein NifE

SCOPe Domain Sequences for d3pdig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pdig_ c.92.2.0 (G:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
gcakpkpgatdggcsfdgaqiallpvadvahivhgpiacagsswdnrgtrssgpdlyrig
mttdltendvimgraekrlfhairqavesysppavfvyntcvpaligddvdavckaaaer
fgtpvipvdsagfygtknlgnriageamlkyvigtrepdplpvgserpgirvhdvnlige
yniagefwhvlplldelglrvlctlagdaryrevqtmhraevnmmvcskamlnvarklqe
tygtpwfegsfygitdtsqalrdfarllddpdltartealiareeakvraalepwrarle
gkrvllytggvkswsvvsalqdlgmkvvatgtkksteedkarirelmgddvkmldegnar
vllktvdeyqadiliaggrnmytalkgrvpfldinqerefgyagydgmlelvrqlcitle
cpvweav

SCOPe Domain Coordinates for d3pdig_:

Click to download the PDB-style file with coordinates for d3pdig_.
(The format of our PDB-style files is described here.)

Timeline for d3pdig_: