Lineage for d3pcoc2 (3pco C:91-327)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1664082Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1664083Protein automated matches [226887] (8 species)
    not a true protein
  7. 1664093Species Escherichia coli [TaxId:562] [256019] (1 PDB entry)
  8. 1664095Domain d3pcoc2: 3pco C:91-327 [248464]
    Other proteins in same PDB: d3pcoc1
    automated match to d1jjca_
    protein/DNA complex; protein/RNA complex; complexed with amp, phe

Details for d3pcoc2

PDB Entry: 3pco (more details), 3.02 Å

PDB Description: crystal structure of e. coli phenylalanine-trna synthetase complexed with phenylalanine and amp
PDB Compounds: (C:) Phenylalanyl-tRNA synthetase, alpha subunit

SCOPe Domain Sequences for d3pcoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcoc2 d.104.1.0 (C:91-327) automated matches {Escherichia coli [TaxId: 562]}
tidvslpgrriengglhpvtrtidriesffgelgftvatgpeieddyhnfdalnipghhp
aradhdtfwfdttrllrtqtsgvqirtmkaqqppiriiapgrvyrndydqthtpmfhqme
glivdtnisftnlkgtlhdflrnffeedlqirfrpsyfpftepsaevdvmgkngkwlevl
gcgmvhpnvlrnvgidpevysgfafgmgmerltmlrygvtdlrsffendlrflkqfk

SCOPe Domain Coordinates for d3pcoc2:

Click to download the PDB-style file with coordinates for d3pcoc2.
(The format of our PDB-style files is described here.)

Timeline for d3pcoc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pcoc1
View in 3D
Domains from other chains:
(mouse over for more information)
d3pcoa_