Lineage for d3pcoa_ (3pco A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968071Species Escherichia coli [TaxId:562] [256019] (1 PDB entry)
  8. 2968072Domain d3pcoa_: 3pco A: [248462]
    Other proteins in same PDB: d3pcoc1
    automated match to d1jjca_
    protein/DNA complex; protein/RNA complex; complexed with amp, phe

Details for d3pcoa_

PDB Entry: 3pco (more details), 3.02 Å

PDB Description: crystal structure of e. coli phenylalanine-trna synthetase complexed with phenylalanine and amp
PDB Compounds: (A:) Phenylalanyl-tRNA synthetase, alpha subunit

SCOPe Domain Sequences for d3pcoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcoa_ d.104.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
rlaaetidvslpgrriengglhpvtrtidriesffgelgftvatgpeieddyhnfdalni
pghhparadhdtfwfdttrllrtqtsgvqirtmkaqqppiriiapgrvyrndydqthtpm
fhqmeglivdtnisftnlkgtlhdflrnffeedlqirfrpsyfpftepsaevdvmgkngk
wlevlgcgmvhpnvlrnvgidpevysgfafgmgmerltmlrygvtdlrsffendlrflkq
fk

SCOPe Domain Coordinates for d3pcoa_:

Click to download the PDB-style file with coordinates for d3pcoa_.
(The format of our PDB-style files is described here.)

Timeline for d3pcoa_: