Lineage for d3pbra1 (3pbr A:54-221)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004526Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 3004527Protein automated matches [226981] (13 species)
    not a true protein
  7. 3004559Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [228776] (27 PDB entries)
  8. 3004568Domain d3pbra1: 3pbr A:54-221 [248456]
    Other proteins in same PDB: d3pbra2
    automated match to d3pboa1
    complexed with mer

Details for d3pbra1

PDB Entry: 3pbr (more details), 1.95 Å

PDB Description: Crystal structure of PBP3 complexed with meropenem
PDB Compounds: (A:) penicillin-binding protein 3

SCOPe Domain Sequences for d3pbra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pbra1 d.175.1.0 (A:54-221) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
rhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadr
ieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddr
gregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

SCOPe Domain Coordinates for d3pbra1:

Click to download the PDB-style file with coordinates for d3pbra1.
(The format of our PDB-style files is described here.)

Timeline for d3pbra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pbra2