Lineage for d3p99b_ (3p99 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2006000Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (7 PDB entries)
  8. 2006026Domain d3p99b_: 3p99 B: [248451]
    automated match to d4bjka_
    complexed with hem, lnp

Details for d3p99b_

PDB Entry: 3p99 (more details), 3 Å

PDB Description: Sterol 14alpha-demethylase (CYP51) from Trypanosoma brucei in complex with delta7-14alpha-methylene-cyclopropyl-dihydrolanosterol
PDB Compounds: (B:) Sterol 14-alpha-demethylase

SCOPe Domain Sequences for d3p99b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p99b_ a.104.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsr
fflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessl
ipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgllsa
vyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpa
qlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllsh
hdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqll
rdevpdpdyhtmvvgptasqcrvkyirr

SCOPe Domain Coordinates for d3p99b_:

Click to download the PDB-style file with coordinates for d3p99b_.
(The format of our PDB-style files is described here.)

Timeline for d3p99b_: