SCOP 1.69: Domain d1snda_: 1snd A:

Lineage for d1snda_ (1snd A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (65 PDB entries)

8. Domain d1snda_: 1snd A: [24845]

Details for d1snda_

PDB Entry: 1snd, 2 Å

PDB Description: staphylococcal nuclease dimer containing a deletion of residues 114- 119 complexed with calcium chloride and the competitive inhibitor deoxythymidine-3',5'-diphosphate

SCOP Domain Sequences for d1snda_:

Sequence; same for both SEQRES and ATOM records:

>d1snda_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaytheqhlrkseaqa
kkeklniws

Timeline for d1snda_:

• d1snda_ first appeared (with stable ids) in SCOP 1.55
  
• d1snda_ appears in SCOP 1.67
  
• d1snda_ appears in SCOP 1.71
  
• d1snda_ appears in the current release, SCOPe 2.08