Lineage for d1snda_ (1snd A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13575Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 13576Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
  6. 13577Protein Staphylococcal nuclease [50201] (1 species)
  7. 13578Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries)
  8. 13614Domain d1snda_: 1snd A: [24845]

Details for d1snda_

PDB Entry: 1snd (more details), 2 Å

PDB Description: staphylococcal nuclease dimer containing a deletion of residues 114-119 complexed with calcium chloride and the competitive inhibitor deoxythymidine-3',5'-diphosphate

SCOP Domain Sequences for d1snda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1snda_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaytheqhlrkseaqa
kkeklniws

SCOP Domain Coordinates for d1snda_:

Click to download the PDB-style file with coordinates for d1snda_.
(The format of our PDB-style files is described here.)

Timeline for d1snda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sndb_