| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
| Protein automated matches [191144] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries) |
| Domain d3p8hc2: 3p8h C:314-421 [248448] automated match to d1oz2a2 complexed with gol, p8h, so4 |
PDB Entry: 3p8h (more details), 2.55 Å
SCOPe Domain Sequences for d3p8hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p8hc2 b.34.9.0 (C:314-421) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvds
rflvhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn
Timeline for d3p8hc2: