Lineage for d3p8ha1 (3p8h A:206-313)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537363Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1537532Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 1537533Protein automated matches [191144] (3 species)
    not a true protein
  7. 1537543Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries)
  8. 1537596Domain d3p8ha1: 3p8h A:206-313 [248441]
    automated match to d1oz3a1
    complexed with gol, p8h, so4

Details for d3p8ha1

PDB Entry: 3p8h (more details), 2.55 Å

PDB Description: crystal structure of l3mbtl1 (mbt repeat) in complex with a nicotinamide antagonist
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d3p8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p8ha1 b.34.9.0 (A:206-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee

SCOPe Domain Coordinates for d3p8ha1:

Click to download the PDB-style file with coordinates for d3p8ha1.
(The format of our PDB-style files is described here.)

Timeline for d3p8ha1: