Lineage for d3p8bc_ (3p8b C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037235Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) (S)
  5. 3037283Family g.41.9.3: RpoE2-like [111454] (2 proteins)
    Pfam PF04035
  6. 3037287Protein automated matches [254713] (1 species)
    not a true protein
  7. 3037288Species Pyrococcus furiosus [TaxId:2261] [256017] (1 PDB entry)
  8. 3037290Domain d3p8bc_: 3p8b C: [248440]
    automated match to d1ryqa_
    protein/RNA complex; complexed with bme, gol, zn

Details for d3p8bc_

PDB Entry: 3p8b (more details), 1.8 Å

PDB Description: X-ray crystal structure of Pyrococcus furiosus transcription elongation factor Spt4/5
PDB Compounds: (C:) DNA-directed RNA polymerase, subunit e''

SCOPe Domain Sequences for d3p8bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p8bc_ g.41.9.3 (C:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr

SCOPe Domain Coordinates for d3p8bc_:

Click to download the PDB-style file with coordinates for d3p8bc_.
(The format of our PDB-style files is described here.)

Timeline for d3p8bc_: