![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) ![]() |
![]() | Family g.41.9.3: RpoE2-like [111454] (2 proteins) Pfam PF04035 |
![]() | Protein automated matches [254713] (1 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [256017] (1 PDB entry) |
![]() | Domain d3p8bc_: 3p8b C: [248440] automated match to d1ryqa_ protein/RNA complex; complexed with bme, gol, zn |
PDB Entry: 3p8b (more details), 1.8 Å
SCOPe Domain Sequences for d3p8bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p8bc_ g.41.9.3 (C:) automated matches {Pyrococcus furiosus [TaxId: 2261]} sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
Timeline for d3p8bc_: