Lineage for d1snq__ (1snq -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13575Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 13576Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
  6. 13577Protein Staphylococcal nuclease [50201] (1 species)
  7. 13578Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries)
  8. 13616Domain d1snq__: 1snq - [24844]

Details for d1snq__

PDB Entry: 1snq (more details), 1.95 Å

PDB Description: protein stability in staphylococcal nuclease

SCOP Domain Sequences for d1snq__:

Sequence, based on SEQRES records: (download)

>d1snq__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhgkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqll
rkseaqakkeklniws

Sequence, based on observed residues (ATOM records): (download)

>d1snq__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetvekygpeasaftkkmvenakk
ievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkseaq
akkeklniws

SCOP Domain Coordinates for d1snq__:

Click to download the PDB-style file with coordinates for d1snq__.
(The format of our PDB-style files is described here.)

Timeline for d1snq__: