Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [256016] (1 PDB entry) |
Domain d3p83d1: 3p83 D:1-205 [248436] Other proteins in same PDB: d3p83a1, d3p83a2, d3p83b1, d3p83b2, d3p83c1, d3p83c2, d3p83d2, d3p83e2 automated match to d2dffa_ protein/DNA complex; protein/RNA complex |
PDB Entry: 3p83 (more details), 3.05 Å
SCOPe Domain Sequences for d3p83d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p83d1 c.55.3.0 (D:1-205) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias gripscvrmrwktvsnlrqktlddf
Timeline for d3p83d1: