Lineage for d3p83d1 (3p83 D:1-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887225Species Archaeoglobus fulgidus [TaxId:2234] [256016] (1 PDB entry)
  8. 2887226Domain d3p83d1: 3p83 D:1-205 [248436]
    Other proteins in same PDB: d3p83a1, d3p83a2, d3p83b1, d3p83b2, d3p83c1, d3p83c2, d3p83d2, d3p83e2
    automated match to d2dffa_
    protein/DNA complex; protein/RNA complex

Details for d3p83d1

PDB Entry: 3p83 (more details), 3.05 Å

PDB Description: Structure of the PCNA:RNase HII complex from Archaeoglobus fulgidus.
PDB Compounds: (D:) ribonuclease hii

SCOPe Domain Sequences for d3p83d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p83d1 c.55.3.0 (D:1-205) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
gripscvrmrwktvsnlrqktlddf

SCOPe Domain Coordinates for d3p83d1:

Click to download the PDB-style file with coordinates for d3p83d1.
(The format of our PDB-style files is described here.)

Timeline for d3p83d1: