SCOPe 2.08: Domain d3p83c2: 3p83 C:123-243

Lineage for d3p83c2 (3p83 C:123-243)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein automated matches [227006] (3 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [256015] (1 PDB entry)

8. Domain d3p83c2: 3p83 C:123-243 [248435]
   Other proteins in same PDB: d3p83d1, d3p83d2, d3p83e1, d3p83e2, d3p83f_
   automated match to d1rwza2
   protein/DNA complex; protein/RNA complex

Details for d3p83c2

PDB Entry: 3p83, 3.05 Å

PDB Description: Structure of the PCNA:RNase HII complex from Archaeoglobus fulgidus.

PDB Compounds: (C:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d3p83c2:

Sequence; same for both SEQRES and ATOM records:

>d3p83c2 d.131.1.2 (C:123-243) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmteteli
efnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilapri
e

Timeline for d3p83c2:

• d3p83c2 first appeared in SCOPe 2.04
  
• d3p83c2 appears in SCOPe 2.07