![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
![]() | Protein automated matches [227006] (3 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [256015] (1 PDB entry) |
![]() | Domain d3p83b2: 3p83 B:123-244 [248433] Other proteins in same PDB: d3p83d1, d3p83d2, d3p83e1, d3p83e2, d3p83f_ automated match to d1rwza2 protein/DNA complex; protein/RNA complex |
PDB Entry: 3p83 (more details), 3.05 Å
SCOPe Domain Sequences for d3p83b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p83b2 d.131.1.2 (B:123-244) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} pelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmteteli efnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilapri es
Timeline for d3p83b2: