Lineage for d3p83b2 (3p83 B:123-244)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977199Protein automated matches [227006] (3 species)
    not a true protein
  7. 2977200Species Archaeoglobus fulgidus [TaxId:2234] [256015] (1 PDB entry)
  8. 2977204Domain d3p83b2: 3p83 B:123-244 [248433]
    Other proteins in same PDB: d3p83d1, d3p83d2, d3p83e1, d3p83e2, d3p83f_
    automated match to d1rwza2
    protein/DNA complex; protein/RNA complex

Details for d3p83b2

PDB Entry: 3p83 (more details), 3.05 Å

PDB Description: Structure of the PCNA:RNase HII complex from Archaeoglobus fulgidus.
PDB Compounds: (B:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d3p83b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p83b2 d.131.1.2 (B:123-244) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmteteli
efnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilapri
es

SCOPe Domain Coordinates for d3p83b2:

Click to download the PDB-style file with coordinates for d3p83b2.
(The format of our PDB-style files is described here.)

Timeline for d3p83b2: