SCOPe 2.06: Domain d3p83b1: 3p83 B:1-122

Lineage for d3p83b1 (3p83 B:1-122)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein automated matches [227006] (4 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [256015] (1 PDB entry)

8. Domain d3p83b1: 3p83 B:1-122 [248432]
   Other proteins in same PDB: d3p83d1, d3p83d2, d3p83e1, d3p83e2, d3p83f_
   automated match to d1rwza1
   protein/DNA complex; protein/RNA complex

Details for d3p83b1

PDB Entry: 3p83, 3.05 Å

PDB Description: Structure of the PCNA:RNase HII complex from Archaeoglobus fulgidus.

PDB Compounds: (B:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d3p83b1:

Sequence; same for both SEQRES and ATOM records:

>d3p83b1 d.131.1.2 (B:1-122) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
ri

Timeline for d3p83b1:

• d3p83b1 first appeared in SCOPe 2.04
  
• d3p83b1 appears in SCOPe 2.05
  
• d3p83b1 appears in SCOPe 2.07
  
• d3p83b1 appears in the current release, SCOPe 2.08