Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein automated matches [227006] (4 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [256015] (1 PDB entry) |
Domain d3p83b1: 3p83 B:1-122 [248432] Other proteins in same PDB: d3p83d1, d3p83d2, d3p83e1, d3p83e2, d3p83f_ automated match to d1rwza1 protein/DNA complex; protein/RNA complex |
PDB Entry: 3p83 (more details), 3.05 Å
SCOPe Domain Sequences for d3p83b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p83b1 d.131.1.2 (B:1-122) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep ri
Timeline for d3p83b1: