Lineage for d3p83a1 (3p83 A:1-122)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2539893Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2539894Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2540079Family d.131.1.2: DNA polymerase processivity factor [55983] (5 protein domains)
    duplication: consists of two domains of this fold
  6. 2540243Protein automated matches [227006] (3 species)
    not a true protein
  7. 2540244Species Archaeoglobus fulgidus [TaxId:2234] [256015] (1 PDB entry)
  8. 2540245Domain d3p83a1: 3p83 A:1-122 [248430]
    Other proteins in same PDB: d3p83d1, d3p83d2, d3p83e1, d3p83e2, d3p83f_
    automated match to d1rwza1
    protein/DNA complex; protein/RNA complex

Details for d3p83a1

PDB Entry: 3p83 (more details), 3.05 Å

PDB Description: Structure of the PCNA:RNase HII complex from Archaeoglobus fulgidus.
PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d3p83a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p83a1 d.131.1.2 (A:1-122) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
ri

SCOPe Domain Coordinates for d3p83a1:

Click to download the PDB-style file with coordinates for d3p83a1.
(The format of our PDB-style files is described here.)

Timeline for d3p83a1: