![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.0: automated matches [191621] (1 protein) not a true family |
![]() | Protein automated matches [191139] (6 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189399] (4 PDB entries) |
![]() | Domain d3p7ja_: 3p7j A: [248428] automated match to d2fmma_ complexed with gol |
PDB Entry: 3p7j (more details), 2.3 Å
SCOPe Domain Sequences for d3p7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p7ja_ b.34.13.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tgfdrgleaekilgasdnngrltfliqfkgvdqaemvpssvanekiprmvihfyeerls
Timeline for d3p7ja_: