SCOPe 2.08: Domain d3p7ja_: 3p7j A:

Lineage for d3p7ja_ (3p7j A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.0: automated matches [191621] (1 protein)
   not a true family

6. Protein automated matches [191139] (6 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189399] (4 PDB entries)

8. Domain d3p7ja_: 3p7j A: [248428]
   automated match to d2fmma_
   complexed with gol

Details for d3p7ja_

PDB Entry: 3p7j, 2.3 Å

PDB Description: drosophila hp1a chromo shadow domain

PDB Compounds: (A:) heterochromatin protein 1

SCOPe Domain Sequences for d3p7ja_:

Sequence; same for both SEQRES and ATOM records:

>d3p7ja_ b.34.13.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tgfdrgleaekilgasdnngrltfliqfkgvdqaemvpssvanekiprmvihfyeerls

Timeline for d3p7ja_:

• d3p7ja_ first appeared in SCOPe 2.04
  
• d3p7ja_ appears in SCOPe 2.07