Lineage for d3p5sb_ (3p5s B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840000Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 1840044Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 1840045Protein ADP ribosyl cyclase [56631] (4 species)
  7. 1840063Species Cow (Bos taurus) [TaxId:9913] [189248] (3 PDB entries)
  8. 1840069Domain d3p5sb_: 3p5s B: [248427]
    automated match to d3gc6a_
    complexed with avu, nag, so4

Details for d3p5sb_

PDB Entry: 3p5s (more details), 1.95 Å

PDB Description: structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex
PDB Compounds: (B:) CD38 molecule

SCOPe Domain Sequences for d3p5sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p5sb_ c.23.14.3 (B:) ADP ribosyl cyclase {Cow (Bos taurus) [TaxId: 9913]}
rwhgagstadfqkiiqercdtytqtirpgsrsrncqairqafmsafiskdpckatkedyn
slinlapptvpcgqqvfwsktkelaheyakrrrlmtledtllgyladglrwcgepgssdl
niwscpdwrkdcrtnylsvfwevlserfaesacntvrvvlngslenafdsmsifgrveap
nlrpqveleawlvhdtgkppsdscsgssirklksildgrnvkfrcmdnlsrdqfl

SCOPe Domain Coordinates for d3p5sb_:

Click to download the PDB-style file with coordinates for d3p5sb_.
(The format of our PDB-style files is described here.)

Timeline for d3p5sb_: