Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein automated matches [231469] (4 species) not a true protein |
Species Escherichia coli [TaxId:216592] [256014] (2 PDB entries) |
Domain d3p4sb2: 3p4s B:106-243 [248421] Other proteins in same PDB: d3p4sb1, d3p4sc_, d3p4sn1, d3p4so_ automated match to d3p4pb2 complexed with 3np, f3s, fad, fes, sf4 |
PDB Entry: 3p4s (more details), 3.1 Å
SCOPe Domain Sequences for d3p4sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4sb2 a.1.2.1 (B:106-243) automated matches {Escherichia coli [TaxId: 216592]} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d3p4sb2:
View in 3D Domains from other chains: (mouse over for more information) d3p4sc_, d3p4sn1, d3p4sn2, d3p4so_ |