SCOPe 2.08: Domain d3p4rb2: 3p4r B:106-243

Lineage for d3p4rb2 (3p4r B:106-243)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein automated matches [231469] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:216592] [256014] (2 PDB entries)

8. Domain d3p4rb2: 3p4r B:106-243 [248415]
   Other proteins in same PDB: d3p4rb1, d3p4rc_, d3p4rn1, d3p4ro_
   automated match to d3p4pb2
   complexed with f3s, fad, fes, gua, sf4

Details for d3p4rb2

PDB Entry: 3p4r, 3.05 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with glutarate

PDB Compounds: (B:) Fumarate reductase iron-sulfur subunit

SCOPe Domain Sequences for d3p4rb2:

Sequence; same for both SEQRES and ATOM records:

>d3p4rb2 a.1.2.1 (B:106-243) automated matches {Escherichia coli [TaxId: 216592]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

Timeline for d3p4rb2:

• d3p4rb2 first appeared in SCOPe 2.04
  
• d3p4rb2 appears in SCOPe 2.07