Lineage for d3p4rb2 (3p4r B:106-243)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689655Protein automated matches [231469] (5 species)
    not a true protein
  7. 2689664Species Escherichia coli [TaxId:216592] [256014] (2 PDB entries)
  8. 2689665Domain d3p4rb2: 3p4r B:106-243 [248415]
    Other proteins in same PDB: d3p4rb1, d3p4rc_, d3p4rn1, d3p4ro_
    automated match to d3p4pb2
    complexed with f3s, fad, fes, gua, sf4

Details for d3p4rb2

PDB Entry: 3p4r (more details), 3.05 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with glutarate
PDB Compounds: (B:) Fumarate reductase iron-sulfur subunit

SCOPe Domain Sequences for d3p4rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4rb2 a.1.2.1 (B:106-243) automated matches {Escherichia coli [TaxId: 216592]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOPe Domain Coordinates for d3p4rb2:

Click to download the PDB-style file with coordinates for d3p4rb2.
(The format of our PDB-style files is described here.)

Timeline for d3p4rb2: