Lineage for d3p39e_ (3p39 E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947558Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 1947559Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 1947560Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 1947565Protein automated matches [190936] (6 species)
    not a true protein
  7. 1947603Species Influenza A virus [TaxId:680789] [189731] (3 PDB entries)
  8. 1947615Domain d3p39e_: 3p39 E: [248412]
    automated match to d3p38a_
    mutant

Details for d3p39e_

PDB Entry: 3p39 (more details), 3.14 Å

PDB Description: Crystal structure of the NS1 effector domain W182A mutant from influenza A/Vietnam/1203/2004 (H5N1) virus
PDB Compounds: (E:) nonstructural protein 1

SCOPe Domain Sequences for d3p39e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p39e_ d.299.1.1 (E:) automated matches {Influenza A virus [TaxId: 680789]}
kmpasryltdmtleemsrdwfmlmpkqkvagslcikmdqaimdktiilkanfsvifdrle
tlillrafteegaivgeisplpslpghtgedvknaigvliggleandntvrvtetiqrfa
wrn

SCOPe Domain Coordinates for d3p39e_:

Click to download the PDB-style file with coordinates for d3p39e_.
(The format of our PDB-style files is described here.)

Timeline for d3p39e_: