Lineage for d3p2db1 (3p2d B:6-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766195Species Cow (Bos taurus) [TaxId:9913] [231496] (3 PDB entries)
  8. 2766199Domain d3p2db1: 3p2d B:6-176 [248406]
    automated match to d2wtrb1

Details for d3p2db1

PDB Entry: 3p2d (more details), 3 Å

PDB Description: Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding between two non-visual subtypes
PDB Compounds: (B:) Beta-arrestin-2

SCOPe Domain Sequences for d3p2db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p2db1 b.1.18.0 (B:6-176) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gtrvfkksspnckltvylgkrdfvdhldkvdpvdgvvlvdpdylkdrkvfvtltcafryg
redldvlglsfrkdlfianyqafpptpnpprpptrlqerllrklgqhahpffftipqnlp
csvtlqpgpedtgkacgvdfeirafcaksleekshkrnsvrlvirkvqfap

SCOPe Domain Coordinates for d3p2db1:

Click to download the PDB-style file with coordinates for d3p2db1.
(The format of our PDB-style files is described here.)

Timeline for d3p2db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p2db2