SCOPe 2.07: Domain d3p2da2: 3p2d A:177-393

Lineage for d3p2da2 (3p2d A:177-393)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [231496] (3 PDB entries)

8. Domain d3p2da2: 3p2d A:177-393 [248405]
   automated match to d2wtrb2

Details for d3p2da2

PDB Entry: 3p2d, 3 Å

PDB Description: Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding between two non-visual subtypes

PDB Compounds: (A:) Beta-arrestin-2

SCOPe Domain Sequences for d3p2da2:

Sequence, based on SEQRES records:

>d3p2da2 b.1.18.0 (A:177-393) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ekpgpqpsaettrhflmsdrslhleasldkelyyhgeplnvnvhvtnnstktvkkikvsv
rqyadiclfstaqykcpvaqveqddqvspsstfckvytitpllsnnrekrglaldgklkh
edtnlasstivkegankevlgilvsyrvkvklvvsrggdvsvelpfvlmhpkphdhialp
rpqsaapetdapvdtnliefetnyatdddivfedfar

Sequence, based on observed residues (ATOM records):

>d3p2da2 b.1.18.0 (A:177-393) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ekpgpqpsaettrhflmsdrslhleasldkelyyhgeplnvnvhvtnnstktvkkikvsv
rqyadiclfstaqykcpvaqveqddqvspsstfckvytitpllsnnrekrglaldgklkh
edtnlasstivkegankevlgilvsyrvkvklvvsrggdvsvelpfvlmhpkphdivfed
far

Timeline for d3p2da2:

• d3p2da2 first appeared in SCOPe 2.04
  
• d3p2da2 appears in SCOPe 2.06
  
• d3p2da2 appears in the current release, SCOPe 2.08