| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (39 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [231496] (2 PDB entries) |
| Domain d3p2da1: 3p2d A:6-176 [248404] automated match to d2wtrb1 |
PDB Entry: 3p2d (more details), 3 Å
SCOPe Domain Sequences for d3p2da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p2da1 b.1.18.0 (A:6-176) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gtrvfkksspnckltvylgkrdfvdhldkvdpvdgvvlvdpdylkdrkvfvtltcafryg
redldvlglsfrkdlfianyqafpptpnpprpptrlqerllrklgqhahpffftipqnlp
csvtlqpgpedtgkacgvdfeirafcaksleekshkrnsvrlvirkvqfap
Timeline for d3p2da1: