Lineage for d3p10c_ (3p10 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960358Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2960499Family d.79.5.0: automated matches [191525] (1 protein)
    not a true family
  6. 2960500Protein automated matches [190884] (7 species)
    not a true protein
  7. 2960554Species Burkholderia pseudomallei [TaxId:320372] [255904] (9 PDB entries)
  8. 2960563Domain d3p10c_: 3p10 C: [248403]
    automated match to d3re3a_
    complexed with cl, ctn, f69, k, zn

Details for d3p10c_

PDB Entry: 3p10 (more details), 1.7 Å

PDB Description: Crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Burkholderia pseudomallei with cytidine and FOL694, 2-(thiophen-2-yl)phenyl methanol
PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3p10c_:

Sequence, based on SEQRES records: (download)

>d3p10c_ d.79.5.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre

Sequence, based on observed residues (ATOM records): (download)

>d3p10c_ d.79.5.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhffkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadldlpl
drvnvkaktneklgylgrgegieaqaaalvvre

SCOPe Domain Coordinates for d3p10c_:

Click to download the PDB-style file with coordinates for d3p10c_.
(The format of our PDB-style files is described here.)

Timeline for d3p10c_: