SCOPe 2.08: Domain d3p10c_: 3p10 C:

Lineage for d3p10c_ (3p10 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.0: automated matches [191525] (1 protein)
   not a true family

6. Protein automated matches [190884] (7 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [255904] (9 PDB entries)

8. Domain d3p10c_: 3p10 C: [248403]
   automated match to d3re3a_
   complexed with cl, ctn, f69, k, zn

Details for d3p10c_

PDB Entry: 3p10, 1.7 Å

PDB Description: Crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Burkholderia pseudomallei with cytidine and FOL694, 2-(thiophen-2-yl)phenyl methanol

PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3p10c_:

Sequence, based on SEQRES records:

>d3p10c_ d.79.5.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre

Sequence, based on observed residues (ATOM records):

>d3p10c_ d.79.5.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhffkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadldlpl
drvnvkaktneklgylgrgegieaqaaalvvre

Timeline for d3p10c_:

• d3p10c_ first appeared in SCOPe 2.04
  
• d3p10c_ appears in SCOPe 2.07