| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.5.0: automated matches [191525] (1 protein) not a true family |
| Protein automated matches [190884] (7 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:320372] [255904] (9 PDB entries) |
| Domain d3p10b_: 3p10 B: [248402] automated match to d3re3a_ complexed with cl, ctn, f69, k, zn |
PDB Entry: 3p10 (more details), 1.7 Å
SCOPe Domain Sequences for d3p10b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p10b_ d.79.5.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre
Timeline for d3p10b_: