![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.0: automated matches [191525] (1 protein) not a true family |
![]() | Protein automated matches [190884] (7 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:320372] [255904] (9 PDB entries) |
![]() | Domain d3p0zb_: 3p0z B: [248399] automated match to d3re3a_ complexed with cl, ctn, k, msr, zn |
PDB Entry: 3p0z (more details), 1.95 Å
SCOPe Domain Sequences for d3p0zb_:
Sequence, based on SEQRES records: (download)
>d3p0zb_ d.79.5.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]} mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa dldlpldrvnvkaktneklgylgrgegieaqaaalvvre
>d3p0zb_ d.79.5.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]} mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig rhfgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadldlpldr vnvkaktneklgylgrgegieaqaaalvvre
Timeline for d3p0zb_: